Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SPSVASPEHSVESSSYGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSS GDMVQPLSPSQGQSTHVHDAQCENTPEKELPVSPGHRKTPFTKDKHSSRL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      351 to 450

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152571 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • erythroid derived 2
    • HEBP1
    • like 2
    • NF E2 related factor 2
    • NF-E2-related factor 2
    • NF2L2_HUMAN
    • NFE2 related factor 2
    • NFE2-related factor 2
    • Nfe2l2
    • Nrf 2
    • NRF2
    • Nuclear factor
    • Nuclear factor (erythroid derived 2) like 2
    • nuclear factor erythroid 2 like 2
    • Nuclear factor erythroid 2 related factor 2
    • Nuclear factor erythroid 2-related factor 2
    • Nuclear factor erythroid derived 2 like 2
    see all
  • Function
    Transcription activator that binds to antioxidant response (ARE) elements in the promoter regions of target genes. Important for the coordinated up-regulation of genes in response to oxidative stress. May be involved in the transcriptional activation of genes of the beta-globin cluster by mediating enhancer activity of hypersensitive site 2 of the beta-globin locus control region.
  • Tissue specificity
    Widely expressed. Highest expression in adult muscle, kidney, lung, liver and in fetal muscle.
  • Sequence similarities
    Belongs to the bZIP family. CNC subfamily.
    Contains 1 bZIP domain.
  • Domain
    Acidic activation domain in the N-terminus, and DNA binding domain in the C-terminus.
  • Post-translational
    modifications
    Phosphorylation of Ser-40 by PKC in response to oxidative stress dissociates NFE2L2 from its cytoplasmic inhibitor KEAP1, promoting its translocation into the nucleus.
  • Cellular localization
    Cytoplasm > cytosol. Nucleus. Cytosolic under unstressed conditions, translocates into the nucleus upon induction by electrophilic agents.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152571 stained with Coomassie Blue.

References

ab152571 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152571.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up