Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RGKNKVAAQNCRKRKLDIILNLEDDVCNLQAKKETLKREQAQCNKAINIM KQKLHDLYHDIFSRLRDDQGRPVNPNHYALQCTHDGSILIVPKELVASGH KKETQKGKRK
    • Amino acids
      585 to 694
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160565 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • erythroid derived 2
    • like 3
    • NF-E2-related factor 3
    • NF2L3_HUMAN
    • NFE2-related factor 3
    • Nfe2l3
    • NRF3
    • Nuclear factor
    • Nuclear factor erythroid 2-related factor 3
    • Nuclear Factor Erythroid Derived 2 like 3
    see all
  • Function
    Activates erythroid-specific, globin gene expression.
  • Tissue specificity
    Highly expressed in human placenta and also in B-cell and monocyte cell lines. Low expression in heart, brain, lung, skeletal muscle, kidney and pancreas.
  • Sequence similarities
    Belongs to the bZIP family. CNC subfamily.
    Contains 1 bZIP domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160565 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160565 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160565.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up