Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EEATECGENCSFEDDKDLQLPSGFNCNFDFLEEPCGWMYDHAKWLRTTWA SSSSPNDRTFPDDRNFLRLQSDSQREGQYARLISPPVHLPRSPVC
    • Amino acids
      621 to 715
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160215 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC126574
    • Neuropilin 2
    • Neuropilin-2
    • Neuropilin2
    • NP 2
    • NP2
    • NPN 2
    • NPN2
    • NRP 2
    • Nrp2
    • NRP2_HUMAN
    • PRO2714
    • Receptor for VEGF165 and semaphorins class3
    • Vascular endothelial cell growth factor 165 receptor 2
    • Vascular endothelial growth factor 165 receptor 2
    • VEGF1265R2
    • VEGF165R2
    see all
  • Function
    High affinity receptor for semaphorins 3C, 3F, VEGF-165 and VEGF-145 isoforms of VEGF, and the PLGF-2 isoform of PGF.
  • Sequence similarities
    Belongs to the neuropilin family.
    Contains 2 CUB domains.
    Contains 2 F5/8 type C domains.
    Contains 1 MAM domain.
  • Domain
    The tandem CUB domains mediate binding to semaphorin, while the tandem F5/8 domains are responsible for heparin and VEGF binding.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160215 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160215 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160215.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up