Overview

  • Product name
    Recombinant Human NRXN3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PANDRPSTRSDRLAVGFSTTVKDGILVRIDSAPGLGDFLQLHIEQGKIGV VFNIGTVDISIKEERTPVNDGKYHVVRFTRNGGNATLQVDNWPVNEHYPT GRQLTIFNTQ
    • Amino acids
      101 to 210
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160456 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C14orf60
    • KIAA0743
    • Neurexin 3
    • Neurexin III
    • Neurexin III-alpha
    • Neurexin-3
    • Neurexin-3-alpha
    • Neurexin-3-alpha [Precursor]
    • Neurexin-III-beta
    • NRXN3
    see all
  • Relevance
    NRXN3 is a neurexin protein. The neurexins are neuronal proteins that function as cell adhesion molecules during synaptogenesis and in intercellular signaling. Mammalian genomes contain just three neurexin genes. Many neurexin isoforms (>200) may be expressed through the use of two alternative promoters and alternative splicing at up to five different positions.
  • Cellular localization
    Cell Membrane

Images

  • ab160456 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160456 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160456.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up