Overview

  • Product name
    Recombinant Human NSD3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGA VLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGD HVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLK SSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSEGDKS FAEGQT SINKTFKKALEEAAKRFQELKAQRESKEALEIEKNSRKPPPYKHIKANKV IG KVQIQVADLSEIPRCNCKPADENPCGLESECLNRMLQYECHPQVCP AGDRCQNQCF TKRLYPDAEIIKTERRGWGLRTKRSIKKGEFVNEYVGE LIDEEECRLRIKRAHENSVTN FYMLTVTKDRIIDAGPKGNYSRFMNHS CNPNCETQKWTVNGDVRVGLFALCDIPAGM ELTFNYNLDCLGNGRTEC HCGADNCSGFLGVRPKSACASTNEEKAKNAKLKQKRRK IKTEPKQMHE D
    • Molecular weight
      61 kDa including tags
    • Amino acids
      1021 to 1322
    • Tags
      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab196390 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >= 55 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol, 0.05% DTT, 0.49% Glutathione

General Info

  • Alternative names
    • DKFZp667H044
    • FLJ20353
    • Histone lysine N methyltransferase NSD3
    • Histone-lysine N-methyltransferase NSD3
    • MGC126766
    • MGC142029
    • NSD 3
    • NSD3_HUMAN
    • Nuclear set domain containing 3
    • Nuclear SET domain containing protein 3
    • Nuclear SET domain-containing protein 3
    • pp14328
    • Protein whistle
    • Whistle
    • WHSC1 like protein 1
    • WHSC1-like 1 isoform 9 with methyltransferase activity to lysine
    • WHSC1-like protein 1
    • WHSC1L1
    • WHSC1L1 protein
    • Wolf Hirschhorn syndrome candidate 1 like 1
    • Wolf-Hirschhorn syndrome candidate 1-like protein 1
    see all
  • Function
    Histone methyltransferase. Preferentially methylates 'Lys-4' and 'Lys-27' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation, while 'Lys-27' is a mark for transcriptional repression.
  • Tissue specificity
    Highly expressed in brain, heart and skeletal muscle. Expressed at lower level in liver and lung.
  • Involvement in disease
    Defects in WHSC1L1 may be involved in non small cell lung carcinomas (NSCLC). Amplified or overexpressed in NSCLC.
    A chromosomal aberration involving WHSC1L1 is found in childhood acute myeloid leukemia. Translocation t(8;11)(p11.2;p15) with NUP98.
  • Sequence similarities
    Belongs to the class V-like SAM-binding methyltransferase superfamily. Histone-lysine methyltransferase family. SET2 subfamily.
    Contains 1 AWS domain.
    Contains 4 PHD-type zinc fingers.
    Contains 1 post-SET domain.
    Contains 2 PWWP domains.
    Contains 1 SET domain.
  • Cellular localization
    Nucleus. Chromosome.
  • Information by UniProt

Images

  • 4-20% SDS PAGE with Coomassie staining: 5.6 µg ab196390.

References

ab196390 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196390.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up