Overview

  • Product name
    Recombinant Human NSF protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAGRSMQAARCPTDELSLTNCAVVNEKDFQSGQHVIVRTSPNHRYTFTLK THPSVVPGSIAFSLPQRKWAGLSIGQEIEVSLYTFDKAKQCIGTMTIEID FLQKKSIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNEKLFGLLVK DIEAMDPSILKGEPATGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAK TKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMGC KHVKGILLYGPPGCGKTLLARQIGKMLNAREPKVVNGPEILNKYVGESEA NIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTV VNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDE KGRLQILHIHTARMRGHQLLSADVDIKELAVETKNFSGAELEGLVRAAQS TAMNRHIKASTKVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYA SYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKT ALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCV VVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKD VLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKG KKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGASPLDFD
    • Molecular weight
      109 kDa including tags
    • Amino acids
      1 to 744

Specifications

Our Abpromise guarantee covers the use of ab132100 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • N ethylmaleimide sensitive factor
    • N ethylmaleimide sensitive factor like protein
    • N ethylmaleimide sensitive fusion protein
    • N-ethylmaleimide-sensitive fusion protein
    • NEM sensitive fusion protein
    • NEM-sensitive fusion protein
    • NSF
    • NSF_HUMAN
    • SKD 2
    • SKD2
    • Vesicle fusing ATPase
    • Vesicle-fusing ATPase
    • Vesicular fusion protein NSF
    • Vesicular-fusion protein NSF
    see all
  • Function
    Required for vesicle-mediated transport. Catalyzes the fusion of transport vesicles within the Golgi cisternae. Is also required for transport from the endoplasmic reticulum to the Golgi stack. Seem to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin.
  • Sequence similarities
    Belongs to the AAA ATPase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132100

References

ab132100 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132100.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up