Overview

  • Product name
    Recombinant Human NSF protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAGRSMQAARCPTDELSLTNCAVVNEKDFQSGQHVIVRTSPNHRYTFTLK THPSVVPGSIAFSLPQRKWAGLSIGQEIEVSLYTFDKAKQCIGTMTIEID FLQKKSIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNEKLFGLLVK DIEAMDPSILKGEPATGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAK TKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMGC KHVKGILLYGPPGCGKTLLARQIGKMLNAREPKVVNGPEILNKYVGESEA NIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTV VNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDE KGRLQILHIHTARMRGHQLLSADVDIKELAVETKNFSGAELEGLVRAAQS TAMNRHIKASTKVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYA SYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKT ALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCV VVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKD VLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKG KKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGASPLDFD
    • Molecular weight
      109 kDa including tags
    • Amino acids
      1 to 744

Specifications

Our Abpromise guarantee covers the use of ab132100 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • N ethylmaleimide sensitive factor
    • N ethylmaleimide sensitive factor like protein
    • N ethylmaleimide sensitive fusion protein
    • N-ethylmaleimide-sensitive fusion protein
    • NEM sensitive fusion protein
    • NEM-sensitive fusion protein
    • NSF
    • NSF_HUMAN
    • SKD 2
    • SKD2
    • Vesicle fusing ATPase
    • Vesicle-fusing ATPase
    • Vesicular fusion protein NSF
    • Vesicular-fusion protein NSF
    see all
  • Function
    Required for vesicle-mediated transport. Catalyzes the fusion of transport vesicles within the Golgi cisternae. Is also required for transport from the endoplasmic reticulum to the Golgi stack. Seem to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin.
  • Sequence similarities
    Belongs to the AAA ATPase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human NSF protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132100

References for Recombinant Human NSF protein (ab132100)

ab132100 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab132100.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up