Recombinant Human NSFL1C protein (ab163284)

Overview

  • Product name
    Recombinant Human NSFL1C protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDI VTISQATPSSVSRGTAPSDNRVTSFRDLIHDQDEDEEEEEGQRFYAGGSE RSGQQIVGPPRKKSPNELVDDLFKGAKEHGAVAVERVTKSPGETSKPRPF AGGGYRLGAAPEEESAYVAGEKRQHSSQDVHVVLKLWKSGFSLDNGELRS YQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRDEDFVKPKGAF KAFTGEGQKLGSTAPQVLSTSSPAQQAENEAKASSSILIDESEPTTNIQI RLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFILMTTFPNKELAD ESQTLKEANLLNAVIVQRLT
    • Amino acids
      1 to 370
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163284 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DJ776F14.1
    • MGC3347
    • NSF1C_HUMAN
    • NSFL1 (p97) cofactor (p47)
    • NSFL1 cofactor p47
    • NSFL1C
    • OTTHUMP00000029972
    • OTTHUMP00000029974
    • p47
    • P47 protein
    • p97 cofactor p47
    • SHP1 homolog
    • UBX domain protein 2C
    • UBX domain-containing protein 2C
    • UBX1
    • UBXD10
    • UBXN2C
    see all
  • Function
    Reduces the ATPase activity of VCP. Necessary for the fragmentation of Golgi stacks during mitosis and for VCP-mediated reassembly of Golgi stacks after mitosis. May play a role in VCP-mediated formation of transitional endoplasmic reticulum (tER) (By similarity). Inhibits the activity of CTSL (in vitro).
  • Sequence similarities
    Belongs to the NSFL1C family.
    Contains 1 SEP domain.
    Contains 1 UBX domain.
  • Post-translational
    modifications
    Phosphorylated during mitosis. Phosphorylation inhibits interaction with Golgi membranes and is required for the fragmentation of the Golgi stacks during mitosis.
  • Cellular localization
    Nucleus. Golgi apparatus > Golgi stack. Chromosome. Predominantly nuclear in interphase cells. Bound to the axial elements of sex chromosomes in pachytene spermatocytes. A small proportion of the protein is cytoplasmic, associated with Golgi stacks.
  • Information by UniProt

Images

  • ab163284 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163284 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163284.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up