Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KEISEAMKSLPALIEQGEGFSQVLRMQPVIHLQRIHQEVFSSCHRKPDAK PENFITQIETTPTETASRKTSDVVLKRKQTKDCPQRKWYPLRPKKINL
    • Amino acids
      182 to 279
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161840 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4833432M17Rik
    • AI451597
    • C1orf48
    • DC31
    • DC8
    • DKFZp566O1646
    • Gm105
    • Gm984
    • Kinetochore associated protein NSL1 homolog
    • Kinetochore-associated protein NSL1 homolog
    • MIS14
    • NSL1
    • NSL1, MIND kinetochore complex component, homolog (S. cerevisiae)
    • NSL1_HUMAN
    see all
  • Function
    Part of the MIS12 complex which is required for normal chromosome alignment and segregation and kinetochore formation during mitosis.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus. Chromosome > centromere > kinetochore. Associated with the kinetochore.
  • Information by UniProt

Images

  • ab161840 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161840 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161840.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up