Overview

  • Product name
    Recombinant Human NSMAF protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RHVLSTGTDGCLNVIDVQTGMLISSMTSDEPQRCFVWDGNSVLSGSQSGE LLVWDLLGAKISERIQGHTGAVTCIWMNEQCSSIITGGEDRQIIFWKLQY
    • Amino acids
      818 to 917
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160028 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Factor associated with N SMase activation
    • Factor associated with neutral sphingomyelinase
    • Factor associated with neutral sphingomyelinase activation
    • FAN
    • Neutral sphingomyelinase (N SMase) activation associated factor
    • Protein FAN
    see all
  • Relevance
    NSMAF is a novel adaptor protein which mediates the activation of sphingomyelinase by receptors such as tumor necrosis factor receptor type 1 and CD40 and subsequent apoptosis in cardiomyocytes. Inhibition of this factor may provide a novel intervention point for reducing ischemia/reperfusion injury.

Images

  • ab160028 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160028 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160028.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up