Recombinant Human NSP 5 alpha 3 alpha protein (ab164910)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RHNNNMMAKTLEECRVTLEGLKMENGSLKSHLQGEKQKATEASAVEQTAE SCEVQEMLKVARAEKDLLELSCNELRQELLKANGEIKHVSSLLAKVEKDY SYLKEICDHQ
    • Amino acids
      527 to 636
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164910 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cytokinesis and spindle organization B
    • Cytospin B
    • Cytospin-B
    • CYTSB
    • CYTSB_HUMAN
    • FLJ36955
    • HCMOGT
    • HCMOGT 1
    • HCMOGT-1
    • NSP
    • NSP5
    • Nuclear structure protein 5
    • Specc1
    • Spectrin domain with coiled coils 1
    • Sperm antigen HCMOGT 1
    • Sperm antigen HCMOGT-1
    • Sperm antigen with calponin homology and coiled coil domains 1
    • Sperm antigen with calponin homology and coiled-coil domains 1
    • sperm antigen with calponin-like and coiled coil domains 1
    • Structure protein NSP5a3a
    • Structure protein NSP5a3b
    • Structure protein NSP5b3a
    • Structure protein NSP5b3b
    see all
  • Tissue specificity
    Highly expressed in testis. Barely detectable in other tissues. Also highly expressed in some cancer cell lines.
  • Involvement in disease
    Note=A chromosomal aberration involving CYTSB may be a cause of juvenile myelomonocytic leukemia. Translocation t(5;17)(q33;p11.2) with PDGFRB.
  • Sequence similarities
    Belongs to the cytospin-A family.
    Contains 1 CH (calponin-homology) domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab164910 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164910 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164910.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up