Overview

  • Product name
    Recombinant Human NSUN3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLTQLKAKSEGKLAKQICKVVLDHFEKQYSKELGDAWNTVREILTSPSCW QYAVLLNRFNYPFELEKDLHLKGYHTLSQGSLPNYPKSVKCYLSRTPGRI PSERHQIGNLKKYYLLNAASLLPVLALELRDGEKVLDLCAAPGGKSIALL QCACPGYLHCNEYDSLRLRWLRQTLESFIPQPLINVIKVSELDGRKMGDA QPEMFDKVLVDAPCSNDRSWLFSSDSQKASCRISQRRNLPLLQIELLRSA IKALRPGGILVYSTCTLSKAENQDVISEILNSHGNIMPMDIKGIARTCSH DFTFAPTGQECGLLVIPDKGKAWGPMYVAKLKKSWSTGKW
    • Amino acids
      1 to 340
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163752 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 6720484A09Rik
    • AU022521
    • FLJ22109
    • FLJ22609
    • MST077
    • MSTP077
    • NOL1/NOP2/Sun domain family 3
    • NOL1/NOP2/Sun domain family member 3
    • NOP2/Sun domain family member 3
    • NSUN3
    • NSUN3_HUMAN
    • OTTMUSP00000028633
    • Putative methyltransferase NSUN3
    • UG0651E06
    see all
  • Function
    May have S-adenosyl-L-methionine-dependent methyl-transferase activity.
  • Sequence similarities
    Belongs to the methyltransferase superfamily. RsmB/NOP family.
  • Information by UniProt

Images

  • ab163752 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163752 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163752.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up