Overview

  • Product name
    Recombinant Human NT5D1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAQHFSLAACDVVGFDLDHTLCRYNLPESAPLIYNSFAQFLVKEKGYDKE LLNVTPEDWDFCCKGLALDLEDGNFLKLANNGTVLRASHGTKMMTPEVLA EAYGKKEWKHFLSDTGMACRSGKYYFYDNYFDLPGALLCARVVDYLTKLN NGQKTFDFWKDIVAAIQHNYKMSAFKENCGIYFPEIKRDPGRYLHSCPES VKKWLRQLKNAGKILLLITSSHSDYCRLLCEYILGNDFTDLFDIVITNAL KPGFFSHLPSQRPFRTLENDEEQEALPSLDKPGWYSQGNAVHLYELLKKM TGKPEPKVVYFGDSMHSDIFPARHYSNWETVLILEELRGDEGTRSQRPEE SEPLEKKGKYEGPKAKPLNTSSKKWGSFFIDSVLGLENTEDSLVYTWSCK RISTYSTIAIPSIEAIAELPLDYKFTRFSSSNSKTAGYYPNPPLVLSSDE TLISK
    • Amino acids
      1 to 455
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165966 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5' nucleotidase cytosolic II like 1 protein
    • 5' nucleotidase domain containing protein 1
    • 5''-nucleotidase domain-containing protein 1
    • 5'-nucleotidase, cytosolic II-like 1 protein
    • C6orf200
    • dJ486I3.1
    • LP2642
    • MGC131837
    • MGC24302
    • NT5C2L1
    • NT5D1_HUMAN
    • NT5DC1
    see all
  • Sequence similarities
    Belongs to the 5'(3')-deoxyribonucleotidase family.
  • Information by UniProt

Images

  • ab165966 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165966 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165966.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up