Overview

  • Product nameRecombinant Human NT5M protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9NPB1
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGGRALRVLVDMDGVLADFEGGFLRKFRAR FPDQPFIALEDRRGFWVS EQYGRLRPGLSEKAISIWESKNFFFELEPL PGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGP DFL EQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQP PRRRLHSWADDWKAILDSKRPC
    • Molecular weight25 kDa including tags
    • Amino acids32 to 228
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113140 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab113140 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • 3''-nucleotidase
    • 5''
    • 5''(3'')-deoxyribonucleotidase
    • 5'(3')-deoxyribonucleotidase, mitochondrial
    • 5',3'-nucleotidase, mitochondrial
    • Deoxy-5''-nucleotidase 2
    • dNT-2
    • DNT2
    • mitochondrial
    • NT5M
    • NT5M_HUMAN
    see all
  • FunctionDephosphorylates specifically the 5' and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides, and so protects mitochondrial DNA replication from excess dTTP. Has only marginal activity towards dIMP and dGMP.
  • Tissue specificityHighly expressed in heart, brain and skeletal muscle. Detected at very low levels in kidney and pancreas.
  • Sequence similaritiesBelongs to the 5'(3')-deoxyribonucleotidase family.
  • Cellular localizationMitochondrion.
  • Information by UniProt

Recombinant Human NT5M protein images

  • 15% SDS-PAGE analysis of ab113140 (3µg)

References for Recombinant Human NT5M protein (ab113140)

ab113140 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113140.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"