Overview

  • Product nameRecombinant Human NTF2 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP61970
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGDKPIWEQIGSSFIQHYYQLFDNDRTQLG AIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSC IISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG
    • Molecular weight17 kDa including tags
    • Amino acids1 to 127
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99139 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab99139 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • NTF 2
    • NTF-2
    • NTF2
    • NTF2_HUMAN
    • Nuclear transport factor 2
    • Nutf2
    • Placental protein 15
    • PP15
    see all
  • FunctionFacilitates protein transport into the nucleus. Interacts with the nucleoporin p62 and with Ran. Acts at a relatively late stage of nuclear protein import, subsequent to the initial docking of nuclear import ligand at the nuclear envelope. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import.
  • Sequence similaritiesContains 1 NTF2 domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human NTF2 protein images

  • 15% SDS-PAGE analysis of 3µg ab99139

References for Recombinant Human NTF2 protein (ab99139)

ab99139 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99139.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"