Overview

  • Product name
    Recombinant Human NTF2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGDKPIWEQIGSSFIQHYYQLFDNDRTQLG AIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSC IISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG
    • Molecular weight
      17 kDa including tags
    • Amino acids
      1 to 127
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99139 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab99139 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • NTF 2
    • NTF-2
    • NTF2
    • NTF2_HUMAN
    • Nuclear transport factor 2
    • Nutf2
    • Placental protein 15
    • PP15
    see all
  • Function
    Facilitates protein transport into the nucleus. Interacts with the nucleoporin p62 and with Ran. Acts at a relatively late stage of nuclear protein import, subsequent to the initial docking of nuclear import ligand at the nuclear envelope. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import.
  • Sequence similarities
    Contains 1 NTF2 domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human NTF2 protein images

  • 15% SDS-PAGE analysis of 3µg ab99139

References for Recombinant Human NTF2 protein (ab99139)

ab99139 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99139.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up