Recombinant Human NTH1 protein (ab113607)

Overview

  • Product nameRecombinant Human NTH1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP78549
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMCSPQESGMTALSARMLTRSRSLGPGAGPR GCREEPGPLRRREAAAEARKSHSPVKRPRKAQRLRVAYEGSDSEKGEGAE PLKVPVWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRY QVLLSLMLSSQTKDQVTAGAMQRLRARGLTVDSILQTDDATLGKLIYPVG FWRSKVKYIKQTSAILQQHYGGDIPASVAELVALPGVGPKMAHLAMAVAW GTVSGIAVDTHVHRIANRLRWTKKATKSPEETRAALEEWLPRELWHEING LLVGFGQQTCLPVHPRCHACLNQALCPAAQGL
    • Molecular weight37 kDa including tags
    • Amino acids1 to 312
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113607 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 80 % SDS-PAGE.
    ab113607 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 40% Glycerol, 0.88% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • Bifunctional DNA N glycoslyase/DNA (apurinic or apyrimidinic site) lyase
    • DNA glycoslyase/AP lyase
    • Endonuclease III like protein 1
    • Endonuclease III-like protein 1
    • hNTH1
    • NTH 1
    • NTH endonuclease III Like 1
    • nth endonuclease III like 1 (E. coli)
    • NTH1
    • NTHL 1
    • Nthl1
    • NTHL1_HUMAN
    • OCTS 3
    • OCTS3
    see all
  • FunctionHas both an apurinic and/or apyrimidinic endonuclease activity and a DNA N-glycosylase activity. Incises damaged DNA at cytosines, thymines and guanines. Acts on a damaged strand, 5' from the damaged site. Required for the repair of both oxidative DNA damage and spontaneous mutagenic lesions.
  • Tissue specificityWidely expressed with highest levels in heart and lowest levels in lung and liver.
  • Sequence similaritiesBelongs to the Nth/MutY family.
  • Developmental stageExpression levels are regulated during the cell cycle with increased levels during early and mid S-phase.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human NTH1 protein images

  • 15% SDS-PAGE analysis of ab113607 (3µg)

References for Recombinant Human NTH1 protein (ab113607)

ab113607 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your inquiry. I heard back from the lab that ab113607 is not denatured.  I hope this information helps.  Please contact us with any other questions.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"