Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP53384
    • SpeciesHuman
    • SequencePIIGVVENMSPFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDP LIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS
    • Molecular weight37 kDa including tags
    • Amino acids222 to 320

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116953 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC130052
    • Cytosolic Fe S cluster assembly factor NUBP1
    • Cytosolic Fe-S cluster assembly factor NUBP1
    • MGC117406
    • MGC130053
    • NBP
    • NBP 1
    • NBP1
    • NBP35
    • nubp1
    • NUBP1_HUMAN
    • Nucleotide binding protein (e.coli MinD like)
    • Nucleotide binding protein 1
    • Nucleotide binding protein 1 (E.coli MinD like)
    • Nucleotide binding protein 1 (MinD homolog, E. coli)
    • Nucleotide-binding protein 1
    see all
  • FunctionImplicated in the regulation of centrosome duplication (By similarity). Component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for maturation of extramitochondrial Fe/S proteins. May bind and transfer 2 labile 4Fe-4S clusters to target apoproteins.
  • Sequence similaritiesBelongs to the Mrp/NBP35 ATP-binding proteins family. NUBP1/NBP35 subfamily.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human NUBP1 protein images

  • 12.5% SDS-PAGE showing ab116953 at approximately 36.52kDa stained with Coomassie Blue.

References for Recombinant Human NUBP1 protein (ab116953)

ab116953 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116953.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"