Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEAAAEPGNLAGVRHIILVLSGKGGVGKSTISTELALALRHAGKKVGILD VDLCGPSIPRMLGAQGRAVHQCDRGWAPVFLDREQSISLMSVGFLLEKPD EAVVWRGPKKNALIKQFVSDVAWGELDYLVVDTPPGTSDEHMATIEALRP YQPLGALVVTTPQAVSVGDVRRELTFCRKTGLRVMGIVENMSGFTCPHCT ECTSVFSRGGGEELAQLAGVPFLGSVPLDPALMRTLEEGHDFIQEFPGSP AFAALTSIAQKILDATPACLP
    • Amino acids
      1 to 271
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160813 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C447E6.1 (nucleotide binding protein 1 (E.coli MinD like) )
    • CFD1
    • Cytosolic Fe-S cluster assembly factor NUBP2
    • D17Wsu11e
    • Homolog of yeast cytosolic FeS cluster deficient 1
    • NBP 2
    • NUBP1
    • Nubp2
    • NUBP2_HUMAN
    • Nucleotide binding protein 2
    • Nucleotide binding protein 2 (E.coli MinD like)
    • Nucleotide binding protein 2 (MinD homolog, E. coli)
    • Nucleotide-binding protein 2
    see all
  • Function
    Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The NUBP1-NUBP2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins.
  • Tissue specificity
    Widely expressed with highest expression in skeletal muscle.
  • Sequence similarities
    Belongs to the Mrp/NBP35 ATP-binding proteins family. NUBP2/CFD1 subfamily.
  • Developmental stage
    Expressed in fetal brain, lung, liver and kidney.
  • Cellular localization
    Nucleus. Cytoplasm > cytoskeleton > microtubule organizing center > centrosome. Enriched at the centrosomes during mitosis.
  • Information by UniProt

Images

  • ab160813 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160813 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160813.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up