Recombinant Human Nuclear Receptor Corepressor NCoR protein (ab153002)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GQGYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTM RMLSSTPPTPIACAPSAVNQAAPHQQNRIWEREPAPLLSAQYETLSDSDD
    • Amino acids
      2341 to 2440
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153002 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hN CoR
    • hNCoR
    • KIAA1047
    • N CoR
    • N Cor/SMRT corepressor Rip13
    • N CoR1
    • N-CoR
    • N-CoR1
    • NCoR
    • NCOR 1
    • Ncor1
    • NCOR1_HUMAN
    • Nuclear receptor co repressor 1
    • Nuclear receptor corepressor 1
    • Retinoid X receptor interacting protein 13
    • RIP13
    • Rxrip13
    • thyroid hormone and retinoic acid receptor associated corepressor 1
    • TRAC 1
    • TRAC1
    see all
  • Function
    Mediates transcriptional repression by certain nuclear receptors. Part of a complex which promotes histone deacetylation and the formation of repressive chromatin structures which may impede the access of basal transcription factors.
  • Sequence similarities
    Belongs to the N-CoR nuclear receptor corepressors family.
    Contains 2 SANT domains.
  • Domain
    The N-terminal region contains three independent domains that are capable of mediating transcriptional repression (RD1, RD2 and RD3).
    The C-terminal region contains two separate nuclear receptor-interacting domains (ID1 and ID2), each of which contains a conserved sequence referred to as the CORNR box. This motif is necessary and sufficient for binding to unligated nuclear hormone receptors, while sequences flanking the CORNR box determine the precise nuclear hormone receptor specificity.
  • Post-translational
    modifications
    Ubiquitinated; mediated by SIAH2 and leading to its subsequent proteasomal degradation.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab153002 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153002 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153002.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up