Recombinant Human NUCB2 protein (ab101042)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: WB, SDS-PAGE
Description
-
Product name
Recombinant Human NUCB2 protein
See all NUCB2 proteins and peptides -
Purity
> 95 % SDS-PAGE.
Purity as determined by densitometric image analysis: > 95% -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MKHHHHHHASVPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDV LETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL -
Predicted molecular weight
11 kDa including tags -
Amino acids
25 to 106 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab101042 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
SDS-PAGE
-
Form
Lyophilized -
Additional notes
Store lyophilized protein at –20°C. Lyophilized protein remains stable until the expiry date when stored at –20°C.
Previously labelled as Nucleobindin 2.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. Please see notes section.
Constituents: 0.242% Tris, 0.29% Sodium chloride
-
ReconstitutionAdd deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.
General Info
-
Alternative names
- DNA binding protein NEFA
- DNA-binding protein NEFA
- Gastric cancer antigen Zg4
see all -
Function
Calcium-binding protein. May have a role in calcium homeostasis. -
Tissue specificity
Predominantly expressed in spleen, testis and normal stomach. -
Sequence similarities
Belongs to the nucleobindin family.
Contains 2 EF-hand domains. -
Cellular localization
Membrane. Cytoplasm. Secreted. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab101042 has not yet been referenced specifically in any publications.