Recombinant Human Nucleobindin 2 protein (ab101042)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKHHHHHHASVPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDV LETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL
    • Molecular weight
      11 kDa including tags
    • Amino acids
      25 to 106
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101042 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Form
    Lyophilised
  • Additional notes
    Store lyophilized protein at –20°C. Lyophilized protein remains stable until the expiry date when stored at –20°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after one week at 4°C.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 50mM Sodium chloride, 20mM Tris, pH 7.5

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.

General Info

  • Alternative names
    • DNA binding protein NEFA
    • DNA-binding protein NEFA
    • Gastric cancer antigen Zg4
    • HEL S 109
    • NEFA
    • Nefastin 1
    • Nefastin-1
    • Nefastin1
    • Nucb2
    • NUCB2_HUMAN
    • Nucleobindin-2
    • Nucleobinding 2
    • Prepronefastin
    • Prepronesfatin
    see all
  • Function
    Calcium-binding protein. May have a role in calcium homeostasis.
  • Tissue specificity
    Predominantly expressed in spleen, testis and normal stomach.
  • Sequence similarities
    Belongs to the nucleobindin family.
    Contains 2 EF-hand domains.
  • Cellular localization
    Membrane. Cytoplasm. Secreted.
  • Information by UniProt

Recombinant Human Nucleobindin 2 protein images

  • 14% SDS-PAGE analysis of ab101042
    Lane 1: Molecular weight markers; 14, 21, 31, 45, 66, 97 kDa
    Lane 2: ab101042 (reduced and heated, 5µg/lane)
    Lane 3: ab101042 (non-reduced and non-heated, 5µg/lane)

References for Recombinant Human Nucleobindin 2 protein (ab101042)

ab101042 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101042.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up