Recombinant Human Nucleobindin 2 protein (ab101042)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKHHHHHHASVPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDV LETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL
    • Molecular weight
      11 kDa including tags
    • Amino acids
      25 to 106
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101042 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Form
    Lyophilised
  • Additional notes
    Store lyophilized protein at –20°C. Lyophilized protein remains stable until the expiry date when stored at –20°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after one week at 4°C.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 50mM Sodium chloride, 20mM Tris, pH 7.5

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.

General Info

  • Alternative names
    • DNA binding protein NEFA
    • DNA-binding protein NEFA
    • Gastric cancer antigen Zg4
    • HEL S 109
    • NEFA
    • Nefastin 1
    • Nefastin-1
    • Nefastin1
    • Nucb2
    • NUCB2_HUMAN
    • Nucleobindin-2
    • Nucleobinding 2
    • Prepronefastin
    • Prepronesfatin
    see all
  • Function
    Calcium-binding protein. May have a role in calcium homeostasis.
  • Tissue specificity
    Predominantly expressed in spleen, testis and normal stomach.
  • Sequence similarities
    Belongs to the nucleobindin family.
    Contains 2 EF-hand domains.
  • Cellular localization
    Membrane. Cytoplasm. Secreted.
  • Information by UniProt

Images

  • 14% SDS-PAGE analysis of ab101042
    Lane 1: Molecular weight markers; 14, 21, 31, 45, 66, 97 kDa
    Lane 2: ab101042 (reduced and heated, 5µg/lane)
    Lane 3: ab101042 (non-reduced and non-heated, 5µg/lane)

References

ab101042 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101042.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up