Recombinant Human Nucleoside phosphorylase protein (ab101210)

Overview

  • Product nameRecombinant Human Nucleoside phosphorylase protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP00491
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMENGYTYEDYKNTAEWLLSHTKHRPQVAII CGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVM MQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIM LIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQ MGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARH CGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMA SIPLPDKAS
    • Molecular weight34 kDa including tags
    • Amino acids1 to 289
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101210 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab101210 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • FLJ94043
    • FLJ97288
    • FLJ97312
    • Inosine phosphorylase
    • Inosine-guanosine phosphorylase
    • MGC117396
    • MGC125915
    • MGC125916
    • NP
    • Np1
    • Nucleoside phosphorylase
    • PNP
    • Pnp1
    • PNPH_HUMAN
    • PRO1837
    • PUNP
    • Purine nucleoside orthophosphate ribosyltransferase
    • Purine nucleoside phosphorylase
    • Purine nucleoside phosphorylase 5a
    see all
  • Involvement in diseaseDefects in PNP are the cause of purine nucleoside phosphorylase deficiency (PNP deficiency) [MIM:613179]. It leads to a severe T-cell immunodeficiency with neurologic disorder in children.
  • Sequence similaritiesBelongs to the PNP/MTAP phosphorylase family.
  • Cellular localizationCytoplasm > cytoskeleton.
  • Information by UniProt

Recombinant Human Nucleoside phosphorylase protein images

  • 15% SDS-PAGE analysis of ab101210 (3 µg).

References for Recombinant Human Nucleoside phosphorylase protein (ab101210)

ab101210 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101210.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"