Recombinant Human Nucleoside phosphorylase protein (ab101210)

Overview

  • Product name
    Recombinant Human Nucleoside phosphorylase protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMENGYTYEDYKNTAEWLLSHTKHRPQVAII CGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVM MQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIM LIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQ MGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARH CGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMA SIPLPDKAS
    • Molecular weight
      34 kDa including tags
    • Amino acids
      1 to 289
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101210 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab101210 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • FLJ94043
    • FLJ97288
    • FLJ97312
    • Inosine phosphorylase
    • Inosine-guanosine phosphorylase
    • MGC117396
    • MGC125915
    • MGC125916
    • NP
    • Np1
    • Nucleoside phosphorylase
    • PNP
    • Pnp1
    • PNPH_HUMAN
    • PRO1837
    • PUNP
    • Purine nucleoside orthophosphate ribosyltransferase
    • Purine nucleoside phosphorylase
    • Purine nucleoside phosphorylase 5a
    see all
  • Involvement in disease
    Defects in PNP are the cause of purine nucleoside phosphorylase deficiency (PNP deficiency) [MIM:613179]. It leads to a severe T-cell immunodeficiency with neurologic disorder in children.
  • Sequence similarities
    Belongs to the PNP/MTAP phosphorylase family.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab101210 (3 µg).

References

ab101210 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101210.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up