Recombinant Human Nucleostemin protein (ab161976)

Overview

  • Product name
    Recombinant Human Nucleostemin protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IEVVKPMEAASAILSQADARQVVLKYTVPGYRNSLEFFTMLAQRRGMHQK GGIPNVEGAAKLLWSEWTGASLAYYCHPPTSWTPPPYFNESIVVDMKSGF
    • Amino acids
      328 to 427
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161976 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C77032
    • E2 induced gene 3 protein
    • E2-induced gene 3 protein
    • E2IG3
    • Estradiol induced nucleotide binding protein
    • GNL3
    • GNL3_HUMAN
    • Guanine nucleotide binding protein like 3
    • Guanine nucleotide binding protein like 3 (nucleolar)
    • Guanine nucleotide-binding protein-like 3
    • MGC800
    • NNP47
    • Novel nucleolar protein 47
    • NS
    • Nucleolar GTP binding protein 3
    • Nucleolar GTP-binding protein 3
    • Nucleostemin
    • Putative nucleotide binding protein estradiol induced
    see all
  • Function
    May be required to maintain the proliferative capacity of stem cells and may play an important role in tumorigenesis.
  • Tissue specificity
    Increased levels in lung tissue in cancer patients.
  • Sequence similarities
    Belongs to the MMR1/HSR1 GTP-binding protein family.
    Contains 1 G (guanine nucleotide-binding) domain.
  • Domain
    The basic domain (B) allows nucleolar localization in the absence of GTP. The intermediate domain (I) inhibits nucleolar localization by the B domain and is required for exit from the nucleolus. Exit from the nucleolus to the nucleoplasm requires both the I and the acidic (A) domains, and may be triggered by GTP hydrolysis.
    In contrast to other GTP-binding proteins, this family is characterized by a circular permutation of the GTPase motifs described by a G4-G1-G3 pattern.
  • Cellular localization
    Nucleus. Nucleus > nucleolus. Shuttles between the nucleus and nucleolus.
  • Information by UniProt

Images

  • ab161976 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161976 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161976.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up