Recombinant Human NUDT10 protein (ab106890)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGG GMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDPKHRTYVYVLTV TELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPT NGNSMAPSSPDSDPLEHHHHHH
    • Molecular weight
      20 kDa including tags
    • Amino acids
      1 to 164
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106890 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab106890 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 5'''-P1
    • APS 2
    • APS2
    • Diadenosine 5'
    • Diadenosine 5' 5''' P1 P6 hexaphosphate hydrolase 3 alpha
    • Diadenosine hexaphosphate hydrolase (AMP-forming)
    • Diphosphoinositol polyphosphate phosphohydrolase 3, alpha
    • Diphosphoinositol polyphosphate phosphohydrolase 3-alpha
    • Diphosphoinositol polyphosphate phosphohydrolase type 3 alpha
    • DIPP 3 alpha
    • DIPP 3a
    • DIPP-3-alpha
    • DIPP3 alpha
    • DIPP3-alpha
    • DIPP3a
    • hAps 2
    • hAps2
    • hDIPP3alpha
    • Nucleoside diphosphate linked moiety X motif 10
    • Nucleoside diphosphate-linked moiety X motif 10
    • NUD10_HUMAN
    • Nudix (nucleoside diphosphate linked moiety X) type motif 10
    • Nudix motif 10
    • Nudix type motif 10
    • NUDT 10
    • NUDT10
    • P6-hexaphosphate hydrolase 3-alpha
    see all
  • Function
    Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyze the hydrolysis of dinucleoside oligophosphates, with Ap6A and Ap5A being the preferred substrates. The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A. Also able to hydrolyze 5-phosphoribose 1-diphosphate.
  • Tissue specificity
    Mainly expressed in testis and, at lower level in brain. According to PubMed:12121577, it is widely expressed.
  • Sequence similarities
    Belongs to the Nudix hydrolase family. DIPP subfamily.
    Contains 1 nudix hydrolase domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab106890.

References

ab106890 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab106890.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up