Recombinant Human NUDT10 protein (ab106890)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ8NFP7
    • SpeciesHuman
    • SequenceMKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGG GMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDPKHRTYVYVLTV TELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPT NGNSMAPSSPDSDPLEHHHHHH
    • Molecular weight20 kDa including tags
    • Amino acids1 to 164
    • TagsHis tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106890 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab106890 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 5'''-P1
    • APS 2
    • APS2
    • Diadenosine 5'
    • Diadenosine 5' 5''' P1 P6 hexaphosphate hydrolase 3 alpha
    • Diadenosine hexaphosphate hydrolase (AMP-forming)
    • Diphosphoinositol polyphosphate phosphohydrolase 3, alpha
    • Diphosphoinositol polyphosphate phosphohydrolase 3-alpha
    • Diphosphoinositol polyphosphate phosphohydrolase type 3 alpha
    • DIPP 3 alpha
    • DIPP 3a
    • DIPP-3-alpha
    • DIPP3 alpha
    • DIPP3-alpha
    • DIPP3a
    • hAps 2
    • hAps2
    • hDIPP3alpha
    • Nucleoside diphosphate linked moiety X motif 10
    • Nucleoside diphosphate-linked moiety X motif 10
    • NUD10_HUMAN
    • Nudix (nucleoside diphosphate linked moiety X) type motif 10
    • Nudix motif 10
    • Nudix type motif 10
    • NUDT 10
    • NUDT10
    • P6-hexaphosphate hydrolase 3-alpha
    see all
  • FunctionCleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyze the hydrolysis of dinucleoside oligophosphates, with Ap6A and Ap5A being the preferred substrates. The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A. Also able to hydrolyze 5-phosphoribose 1-diphosphate.
  • Tissue specificityMainly expressed in testis and, at lower level in brain. According to PubMed:12121577, it is widely expressed.
  • Sequence similaritiesBelongs to the Nudix hydrolase family. DIPP subfamily.
    Contains 1 nudix hydrolase domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human NUDT10 protein images

  • 15% SDS-PAGE analysis of 3µg ab106890.

References for Recombinant Human NUDT10 protein (ab106890)

ab106890 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab106890.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"