Recombinant Human NUDT12 protein (ab164413)

Overview

  • Product name
    Recombinant Human NUDT12 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSSVKRSLKQEIVTQFHCSAAEGDIAKLTGILSHSPSLLNETSENGWTAL MYAARNGHPEIVQFLLEKGCDRSIVNKSRQTALDIAVFWGYKHIANLLAT AKGGKKPWFLTNEVEECENYFSKTLLDRKSEKRNNSDWLLAKESHPATVF ILFSDLNPLVTLGGNKESFQQPEVRLCQLNYTDIKDYLAQPEKITLIFLG VELEIKDKLLNYAGEVPREEEDGLVAWFALGIDPIAAEEFKQRHENCYFL HPPMPALLQLKEKEAGVVAQARSVLAWHSRYKFCPTCGNATKIEEGGYKR LCLKEDCPSLNGVHNTSYPRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMF TCLAGFIEPGETIEDAVRREVEEESGVKVGHVQYVACQPWPMPSSLMIGC LALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFFVPPSRAIAHQ LIKHWIRINPNL
    • Amino acids
      1 to 462
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164413 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 0610016O18Rik
    • DKFZP761I172
    • EC 3.6.1.22
    • Nucleoside diphosphate linked moiety X motif 12
    • Nucleoside diphosphate linked moiety X type motif 12
    • Nudix (nucleoside diphosphate linked moiety X) type motif 12
    • Nudix motif 12
    • Nudix type motif 12
    • NUDT 12
    • Peroxisomal NADH pyrophosphatase NUDT12
    see all
  • Relevance
    Nucleotides are involved in numerous biochemical reactions and pathways within the cell as substrates, cofactors, and effectors. Nudix hydrolases, such as NUDT12 (Nudix (nucleoside diphosphate linked moiety X)-type motif 12), regulate the concentrations of individual nucleotides and of nucleotide ratios in response to changing circumstances. NUDT12 hydrolyzes NAD(P)H to NMNH and AMP (2',5'-ADP), and diadenosine diphosphate to AMP. It also has moderate activity towards NAD(P)(+), ADP-ribose and diadenosine triphosphate. It may regulate the concentration of peroxisomal nicotinamide nucleotide cofactors required for oxidative metabolism.
  • Cellular localization
    Peroxisome

Images

  • ab164413 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164413 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164413.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up