Recombinant Human NUDT16 protein (ab103059)

Overview

  • Product nameRecombinant Human NUDT16 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ96DE0
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAGARRLELGEALALGSGWRHACHALLYAP DPGMLFGRIPLRYAILMQMRFDGRLGFPGGFVDTQDRSLEDGLNRELREE LGEAAAAFRVERTDYRSSHVGSGPRVVAHFYAKRLTLEELLAVEAGATRA KDHGLEVLGLVRVPLYTLRDGVGGLPTFLENSFIGSAREQLLEALQDLGL LQSGSISGLKIPAHH
    • Molecular weight23 kDa including tags
    • Amino acids1 to 195
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103059 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab103059 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • FLJ31265
    • FLJ34034
    • FLJ36248
    • Nucleoside diphosphate-linked moiety X motif 16
    • NUD16_HUMAN
    • Nudix (nucleoside diphosphate linked moiety X) type motif 16
    • Nudix motif 16
    • NUDT 16
    • NUDT16
    • U8 snoRNA-binding protein H29K
    • U8 snoRNA-decapping enzyme
    see all
  • FunctionRNA-decapping enzyme that binds specifically to U8 snoRNA. Part of the U8 snoRNP complex that is required for the accumulation of mature 5.8S and 28S rRNA. Has diphosphatase activity and removes m7G and m227G caps from U8 snoRNA. Has broad substrate specificity with manganese or cobalt as cofactor and can act on various RNA species (in vitro).
  • Sequence similaritiesBelongs to the Nudix hydrolase family.
    Contains 1 nudix hydrolase domain.
  • Cellular localizationNucleus > nucleolus. Nucleus > nucleoplasm. Predominantly localized in nucleolus, and in a minor proportion in distinct foci in the nucleoplasm.
  • Information by UniProt

Recombinant Human NUDT16 protein images

  • 15% SDS-PAGE (3 µg)

References for Recombinant Human NUDT16 protein (ab103059)

ab103059 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103059.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"