Recombinant Human NUDT16 protein (ab103059)

Overview

  • Product name
    Recombinant Human NUDT16 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAGARRLELGEALALGSGWRHACHALLYAP DPGMLFGRIPLRYAILMQMRFDGRLGFPGGFVDTQDRSLEDGLNRELREE LGEAAAAFRVERTDYRSSHVGSGPRVVAHFYAKRLTLEELLAVEAGATRA KDHGLEVLGLVRVPLYTLRDGVGGLPTFLENSFIGSAREQLLEALQDLGL LQSGSISGLKIPAHH
    • Molecular weight
      23 kDa including tags
    • Amino acids
      1 to 195
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103059 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab103059 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • FLJ31265
    • FLJ34034
    • FLJ36248
    • Nucleoside diphosphate-linked moiety X motif 16
    • NUD16_HUMAN
    • Nudix (nucleoside diphosphate linked moiety X) type motif 16
    • Nudix motif 16
    • NUDT 16
    • NUDT16
    • U8 snoRNA-binding protein H29K
    • U8 snoRNA-decapping enzyme
    see all
  • Function
    RNA-decapping enzyme that binds specifically to U8 snoRNA. Part of the U8 snoRNP complex that is required for the accumulation of mature 5.8S and 28S rRNA. Has diphosphatase activity and removes m7G and m227G caps from U8 snoRNA. Has broad substrate specificity with manganese or cobalt as cofactor and can act on various RNA species (in vitro).
  • Sequence similarities
    Belongs to the Nudix hydrolase family.
    Contains 1 nudix hydrolase domain.
  • Cellular localization
    Nucleus > nucleolus. Nucleus > nucleoplasm. Predominantly localized in nucleolus, and in a minor proportion in distinct foci in the nucleoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE (3 µg)

References

ab103059 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab103059.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up