Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP50583
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMALRACGLIIFRRCLIPKVDNNAIEFLLLQ ASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKREL NYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKE MKAALQEGHQFLCSIEA
    • Molecular weight19 kDa including tags
    • Amino acids1 to 147
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103048 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab103048 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris buffer, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 2310051L06Rik
    • 5''''-P1
    • AA939917
    • Ap4A hydrolase
    • Ap4A hydrolase 1
    • AP4A_HUMAN
    • Ap4Aase
    • APAH 1
    • APAH1
    • Bis(5' nucleosyl) tetraphosphatase [asymmetrical]
    • Bis(5''-nucleosyl)-tetraphosphatase [asymmetrical]
    • Diadenosine 5''
    • Diadenosine 5',5''' P1,P4 tetraphosphate asymmetrical hydrolase
    • Diadenosine 5',5''-P1,P4-tetraphosphate pyrophosphohydrolase
    • Diadenosine tetraphosphatase
    • EC 3.6.1.17
    • MGC10404
    • Nucleoside diphosphate linked moiety X motif 2
    • Nucleoside diphosphate-linked moiety X motif 2
    • nudix (nucleoside diphosphate linked moiety X)-type motif 2
    • Nudix motif 2
    • Nudix-type motif 2
    • NUDT 2
    • NUDT2
    • OTTHUMP00000021256
    • OTTHUMP00000021257
    • OTTHUMP00000021258
    • OTTHUMP00000021259
    • P4-tetraphosphate asymmetrical hydrolase
    see all
  • FunctionAsymmetrically hydrolyzes Ap4A to yield AMP and ATP. Plays a major role in maintaining homeostasis.
  • Sequence similaritiesBelongs to the Nudix hydrolase family.
    Contains 1 nudix hydrolase domain.
  • Information by UniProt

Recombinant Human NUDT2 protein images

  • 15% SDS-PAGE analysis of ab103048 (3µg)

References for Recombinant Human NUDT2 protein (ab103048)

ab103048 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103048.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"