Overview

  • Product name
    Recombinant Human NUDT2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMALRACGLIIFRRCLIPKVDNNAIEFLLLQ ASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKREL NYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKE MKAALQEGHQFLCSIEA
    • Molecular weight
      19 kDa including tags
    • Amino acids
      1 to 147
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103048 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab103048 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris buffer, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 2310051L06Rik
    • 5''''-P1
    • AA939917
    • Ap4A hydrolase
    • Ap4A hydrolase 1
    • AP4A_HUMAN
    • Ap4Aase
    • APAH 1
    • APAH1
    • Bis(5' nucleosyl) tetraphosphatase [asymmetrical]
    • Bis(5''-nucleosyl)-tetraphosphatase [asymmetrical]
    • Diadenosine 5''
    • Diadenosine 5',5''' P1,P4 tetraphosphate asymmetrical hydrolase
    • Diadenosine 5',5''-P1,P4-tetraphosphate pyrophosphohydrolase
    • Diadenosine tetraphosphatase
    • EC 3.6.1.17
    • MGC10404
    • Nucleoside diphosphate linked moiety X motif 2
    • Nucleoside diphosphate-linked moiety X motif 2
    • nudix (nucleoside diphosphate linked moiety X)-type motif 2
    • Nudix motif 2
    • Nudix-type motif 2
    • NUDT 2
    • NUDT2
    • OTTHUMP00000021256
    • OTTHUMP00000021257
    • OTTHUMP00000021258
    • OTTHUMP00000021259
    • P4-tetraphosphate asymmetrical hydrolase
    see all
  • Function
    Asymmetrically hydrolyzes Ap4A to yield AMP and ATP. Plays a major role in maintaining homeostasis.
  • Sequence similarities
    Belongs to the Nudix hydrolase family.
    Contains 1 nudix hydrolase domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab103048 (3µg)

References

ab103048 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab103048.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up