Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPG GGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLT VTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSP ANGNSTVPSLPDNNALFVTAAQTSGLPSSVR
    • Amino acids
      1 to 181
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161332 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Diadenosine 5' 5''' P1 P6 hexaphosphate hydrolase 2
    • Diphosphoinositol polyphosphate phosphohydrolase 2
    • Diphosphoinositol polyphosphate phosphohydrolase type 2
    • DIPP 2
    • DIPP2
    • DIPP2alpha
    • DIPP2beta
    • DKFZp686I1281
    • HDCMB47P
    • KIAA0487
    • Nucleoside diphosphate linked moiety X motif 4
    • Nudix (nucleoside diphosphate linked moiety X) type motif 4
    • Nudix motif 4
    • Nudix type motif 4
    • NUDT 4
    see all
  • Relevance
    NUDT4 (Nudix (nucleoside diphosphate linked moiety X)-type motif 4) is a member of the DIPP subfamily of Nudix proteins which hydrolyze specific diphosphoinositol polyphosphates and diadenosine polyphosphates. NUDT4 cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), PP-InsP4 and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. It is also able to catalyze the hydrolysis of dinucleoside oligophosphate Ap6A, but not Ap5A.
  • Cellular localization
    Cytoplasmic

Images

  • ab161332 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161332 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161332.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up