Overview

  • Product nameRecombinant Human NUDT5 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9UKK9
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMESQEPTESSQNGKQYIISEELISEGKWVK LEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLV KQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAV CMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQ RLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF
    • Molecular weight27 kDa including tags
    • Amino acids1 to 219
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116464 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 85 % SDS-PAGE.
    ab116464 is purified by proprietary chromatographic techniques and filter sterilized.
  • FormLiquid
  • Additional notesab116464 although stable at 4°C for 1 week, should be stored desiccated below -18°C. Please prevent freeze thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 10% Glycerol, 0.02% DTT, 0.24% Tris, 0.58% Sodium chloride

General Info

  • Alternative names
    • ADP sugar pyrophosphatase
    • ADP-sugar pyrophosphatase
    • hYSAH 1
    • hYSAH1
    • Nucleoside diphosphate linked moiety X motif 5
    • Nucleoside diphosphate linked moiety X type motif 5
    • Nucleoside diphosphate-linked moiety X motif 5
    • Nudix (nucleoside diphosphate linked moiety X) type motif 5
    • Nudix motif 5
    • Nudix type motif 5
    • NUDT 5
    • Nudt5
    • NUDT5_HUMAN
    • YSA1
    • YSA1H
    see all
  • FunctionHydrolyzes with similar activities ADP-ribose, ADP-mannose, and ADP-glucose. Can also hydrolyze other nucleotide sugars with low activity.
  • Tissue specificityWidely expressed. Most abundant in liver.
  • Sequence similaritiesBelongs to the Nudix hydrolase family.
    Contains 1 nudix hydrolase domain.
  • Information by UniProt

References for Recombinant Human NUDT5 protein (ab116464)

ab116464 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116464.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"