Overview

  • Product name
    Recombinant Human NUDT5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMESQEPTESSQNGKQYIISEELISEGKWVK LEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLV KQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAV CMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQ RLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF
    • Molecular weight
      27 kDa including tags
    • Amino acids
      1 to 219
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116464 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.
    ab116464 is purified by proprietary chromatographic techniques and filter sterilized.
  • Form
    Liquid
  • Additional notes
    ab116464 although stable at 4°C for 1 week, should be stored desiccated below -18°C. Please prevent freeze thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 10% Glycerol, 0.02% DTT, 0.24% Tris, 0.58% Sodium chloride

General Info

  • Alternative names
    • ADP sugar pyrophosphatase
    • ADP-sugar pyrophosphatase
    • hYSAH 1
    • hYSAH1
    • Nucleoside diphosphate linked moiety X motif 5
    • Nucleoside diphosphate linked moiety X type motif 5
    • Nucleoside diphosphate-linked moiety X motif 5
    • Nudix (nucleoside diphosphate linked moiety X) type motif 5
    • Nudix motif 5
    • Nudix type motif 5
    • NUDT 5
    • Nudt5
    • NUDT5_HUMAN
    • YSA1
    • YSA1H
    see all
  • Function
    Hydrolyzes with similar activities ADP-ribose, ADP-mannose, and ADP-glucose. Can also hydrolyze other nucleotide sugars with low activity.
  • Tissue specificity
    Widely expressed. Most abundant in liver.
  • Sequence similarities
    Belongs to the Nudix hydrolase family.
    Contains 1 nudix hydrolase domain.
  • Information by UniProt

References

ab116464 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116464.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up