Overview

  • Product name
    Recombinant Human NUDT9 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMNTNVMSGSNGSKENSHNKARTSPYPGSKV ERSQVPNEKVGWLVEWQDYKPVEYTAVSVLAGPRWADPQISESNFSPKFN EKDGHVERKSKNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHAADPII TRWKRDSSGNKIMHPVSGKHILQFVAIKRKDCGEWAIPGGMVDPGEKISA TLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHLVIYKGYVDDPRNT DNAWMETEAVNYHDETGEIMDNLMLEAGDDAGKVKWVDINDKLKLYASHS QFIKLVAEKRDAHWSEDSEADCHAL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      47 to 350
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107153 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab107153 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Adenosine diphosphoribose pyrophosphatase
    • ADP ribose diphosphatase
    • ADP ribose phosphohydrolase
    • ADP ribose pyrophosphatase, mitochondrial precursor
    • ADP ribose pyrosphosphatase NUDT9
    • ADP-ribose diphosphatase
    • ADP-ribose phosphohydrolase
    • ADP-ribose pyrophosphatase, mitochondrial
    • ADPR PPase
    • ADPR-PPase
    • EC 3.6.1.13
    • Nucleoside diphosphate linked moiety X motif 9
    • Nucleoside diphosphate linked moiety X type motif 9
    • Nucleoside diphosphate-linked moiety X motif 9
    • Nudix (nucleoside diphosphate linked moiety X) type motif 9
    • Nudix hydrolase 9
    • Nudix motif 9
    • NUDT10
    • NUDT9
    • NUDT9_HUMAN
    see all
  • Function
    Hydrolyzes ADP-ribose (ADPR) to AMP and ribose 5'-phosphate.
  • Tissue specificity
    Ubiquitously expressed but isoform 1 is the most predominant isoform.
  • Sequence similarities
    Belongs to the Nudix hydrolase family. NudF subfamily.
    Contains 1 nudix hydrolase domain.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Recombinant Human NUDT9 protein images

  • 15% SDS-PAGE showing ab107153 (3µg).
    Note: Molecular weight on SDS-PAGE will appear higher.

References for Recombinant Human NUDT9 protein (ab107153)

ab107153 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107153.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up