Recombinant Human NUFIP1 protein (ab162037)

Overview

  • Product name
    Recombinant Human NUFIP1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MHAPGMKKIKLDTPEEIARWREERRKNYPTLANIERKKKLKLEKEKRGAV LTTTQYGKMKGMSRHSQMAKIRSPGKNHKWKNDNSRQRAVTGSGSHLCDL KLEGPPEANADPLGVLINSDSESDKEEKPQHSVIPKEVTPALCSLMSSYG SLSGSESEPEETPIKTEADVLAENQVLDSSAPKSPSQDVKATVRNFSEAK SENRKKSFEKTNPKRKKDYHNYQTLFEPRTHHPYLLEMLLAPDIRHERNV ILQCVRYIIKKDFFGLDTNSAKSKDV
    • Amino acids
      1 to 276
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162037 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA540M5.1
    • Nuclear FMRP interacting protein 1
    • Nuclear fragile X mental retardation interacting protein 1
    • nuclear fragile X mental retardation protein interacting protein 1
    • NUFIP
    see all
  • Relevance
    NUFIP1 contains 1 C2H2- type zinc finger and binds RNA. It interacts with FMR1. NUFIP1 may be associated with preinitiation complexes, open transcription complexes, and elongation complexes. It may facilitate ATP-dependent dissociation of hyperphosphorylated pol II from open transcription complexes.
  • Cellular localization
    Nuclear

Images

  • ab162037 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162037 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162037.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up