Overview

  • Product name
    Recombinant Human NuMA protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAENRKLLTEKDA QIAMMQQRIDRLALLNEKQAASPLEPKELEELRDKNESLTMRLHETLKQC QDLKTEK
    • Molecular weight
      37 kDa
    • Amino acids
      200 to 306

Specifications

Our Abpromise guarantee covers the use of ab114324 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Centrophilin stabilizes mitotic spindle in mitotic cells
    • NMP 22
    • Nuclear matrix protein 22
    • Nuclear mitotic apparatus protein
    • Nuclear mitotic apparatus protein 1
    • NUMA
    • NUMA 1
    • NuMA protein
    • NUMA1
    • NUMA1_HUMAN
    • SP H antigen
    • SP-H antigen
    • Structural nuclear protein
    see all
  • Function
    May be a structural component of the nucleus.
  • Cellular localization
    Nucleus. Chromosome. Dissociates from condensing chromosomes during early prophase, before the complete disintegration of the nuclear lamina. As mitosis progresses it reassociates with telophase chromosomes very early during nuclear reformation, before substantial accumulation of lamins on chromosomal surfaces is evident.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab114324 on a 12.5% gel stained with Coomassie Blue.

References

ab114324 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114324.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up