Recombinant Human Nup153 protein (ab153032)

Overview

  • Product name
    Recombinant Human Nup153 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QQPSQSAFGSGTTPNSSSAFQFGSSTTNFNFTNNSPSGVFTFGANSSTPA ASAQPSGSGGFPFNQSPAAFTVGSNGKNVFSSSGTSFSGRKIKTAVRRRK
    • Amino acids
      1376 to 1475
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153032 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 153 kDa nucleoporin
    • HNUP153
    • N153
    • NU153_HUMAN
    • Nuclear pore complex protein hnup153
    • Nuclear pore complex protein Nup153
    • Nucleoporin 153kDa
    • Nucleoporin Nup153
    • Nup 153
    • Nup153
    see all
  • Function
    Possible DNA-binding subunit of the nuclear pore complex (NPC). The repeat-containing domain may be involved in anchoring components of the pore complex to the pore membrane.
  • Sequence similarities
    Contains 4 RanBP2-type zinc fingers.
  • Domain
    Contains F-X-F-G repeats.
  • Cellular localization
    Nucleus > nuclear pore complex. Located to the terminal ring structure of the nucleoplasmic cage.
  • Information by UniProt

Images

  • ab153032 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153032 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153032.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up