Recombinant Human NUP214 protein (ab152837)

Overview

  • Product name
    Recombinant Human NUP214 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGDEMDAMIPEREMKDFQFRALKKVRIFDSPEELPKERSSLLAVSNKYGL VFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHH
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 97

Specifications

Our Abpromise guarantee covers the use of ab152837 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 214 kDa nucleoporin
    • CAIN
    • CAN
    • CAN protein putative oncogene
    • D9S46E
    • N214
    • NU214_HUMAN
    • Nuclear pore complex protein Nup214
    • nucleoporin 214kDa
    • Nucleoporin Nup214
    • Nup214
    • p250
    • Protein CAN
    see all
  • Function
    May serve as a docking site in the receptor-mediated import of substrates across the nuclear pore complex.
  • Tissue specificity
    Expressed in thymus, spleen, bone marrow, kidney, brain and testis, but hardly in all other tissues or in whole embryos during development.
  • Involvement in disease
    Note=A chromosomal aberration involving NUP214 is found in a subset of acute myeloid leukemia (AML); also known as acute non-lymphocytic leukemia. Translocation t(6;9)(p23;q34) with DEK. It results in the formation of a DEK-CAN fusion gene.
    Note=A chromosomal aberration involving NUP214 is found in some cases of acute undifferentiated leukemia (AUL). Translocation t(6;9)(q21;q34.1) with SET.
  • Domain
    Contains FG repeats.
  • Post-translational
    modifications
    Probably glycosylated as it reacts with wheat germ agglutinin (WGA).
  • Cellular localization
    Nucleus > nuclear pore complex. Cytoplasmic filaments.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152837 stained with Coomassie Blue.

References

ab152837 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152837.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up