Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRT GKNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKD
    • Amino acids
      342 to 439
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161143 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 50 kDa nucleoporin
    • NPAP60
    • NPAP60L
    • Nuclear pore associated protein 60L
    • Nuclear pore complex protein Nup50
    • Nuclear pore-associated protein 60 kDa-like
    • Nucleoporin 50
    • Nucleoporin 50kDa
    • Nucleoporin Nup50
    • Nup50
    • NUP50_HUMAN
    • PRO1146
    see all
  • Function
    Component of the nuclear pore complex that has a direct role in nuclear protein import. Actively displaces NLSs from importin-alpha, and facilitates disassembly of the importin-alpha:beta-cargo complex and importin recycling. Interacts with multiple transport receptor proteins including CDKN1B. This interaction is required for correct intracellular transport and degradation of CDKN1B.
  • Tissue specificity
    Ubiquitous. Highest levels in testis, peripheral blood leukocytes and fetal liver.
  • Sequence similarities
    Contains 1 RanBD1 domain.
  • Domain
    Contains FG repeats.
  • Cellular localization
    Nucleus > nuclear pore complex. Nucleus membrane. Localizes to the nucleoplasmic fibrils of the nuclear pore complex.
  • Information by UniProt

Images

  • ab161143 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161143 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161143.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up