Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAFAVEPQGPALGSEPMMLGSPTSPKPGVNAQFLPGFLMGDLPAPVTPQ PRSISGPSVGVMEMRSPLLAGGSPPQPVVPAHKDKSGAPPVRSIYDDISS PGLGSTPLTSRRQPNISVMQSPLVGVTSTPGTGQSMFSPASIGQPRKTTL SPAQLDPFYTQGDSLTSEDHLDDSWVTVFGFPQASASYILLQFAQYGNIL KHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGVKPCIDKSVME SSDRCALSSPSLAFTPPIKTLGTPTQPGSTPRISTMRPLATAYKASTSDY QVISDRQTPKKDESLVSKAMEYMFGW
    • Amino acids
      1 to 326
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165312 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 35 kDa nucleoporin
    • Mitotic phosphoprotein 44
    • MP 44
    • MP-44
    • NP 44
    • NP44
    • Nuclear pore complex protein 53kDa
    • Nuclear pore complex protein Nup 53
    • Nuclear pore complex protein Nup53
    • Nuclear pore protein NUP 53
    • Nuclear pore protein NUP53
    • Nucleoporin 35kDa
    • Nucleoporin 53kDa
    • Nucleoporin Nup 35
    • Nucleoporin NUP 53
    • Nucleoporin Nup35
    • Nucleoporin NUP53
    • NUP 35
    • Nup 53
    • NUP35
    • NUP53
    • NUP53_HUMAN
    see all
  • Function
    Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs). Can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. May play a role in the association of MAD1 with the NPC.
  • Sequence similarities
    Belongs to the Nup53 family.
    Contains 1 RRM Nup35-type domain.
  • Cellular localization
    Nucleus > nuclear pore complex. Nucleus membrane. Tightly associated with the nuclear membrane and lamina.
  • Information by UniProt

Images

  • ab165312 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165312 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165312.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up