Overview

  • Product name
    Recombinant Human NUP98 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLP EAQIVKHWSLTWTLCEALWGHLKELDSQLNEPREYIQILERRRAFSRWLS CTATPQIEEE
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159019 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 96 kDa nucleoporin
    • 98 kDa nucleoporin
    • ADAR2
    • ADIR2
    • GLFG-repeat containing nucleoporin
    • Nuclear pore complex protein Nup96
    • Nuclear pore complex protein Nup98 Nup96
    • Nucleoporin 98kD
    • nucleoporin 98kDa
    • Nucleoporin Nup96
    • Nucleoporin Nup98
    • NUP196
    • NUP96
    • Nup98
    • Nup98-Nup96
    • NUP98_HUMAN
    see all
  • Function
    Nup98 and Nup96 play a role in the bidirectional transport across the nucleoporin complex (NPC). The repeat domain in Nup98 has a direct role in the transport.
  • Involvement in disease
    Note=A chromosomal aberration involving NUP98 is found in a form of acute myeloid leukemia. Translocation t(7;11)(p15;p15) with HOXA9. Translocation t(11;17)(p15;p13) with PHF23.
    Note=A chromosomal aberration involving NUP98 is found in childhood acute myeloid leukemia. Translocation t(5;11)(q35;p15.5) with NSD1. Translocation t(8;11)(p11.2;p15) with WHSC1L1.
    Note=A chromosomal aberration involving NUP98 is found in a form of therapy-related myelodysplastic syndrome. Translocation t(11;20)(p15;q11) with TOP1.
    Note=A chromosomal aberration involving NUP98 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(3;11)(q12.2;p15.4) with LNP1.
    Note=A chromosomal aberration involving NUP98 is associated with pediatric acute myeloid leukemia (AML) with intermediate characteristics between M2-M3 French-American-British (FAB) subtypes. Translocation t(9;11)(p22;p15) with PSIP1/LEDGF. The chimeric transcript is an in-frame fusion of NUP98 exon 8 to PSIP1/LEDGF exon 4.
  • Sequence similarities
    Belongs to the nucleoporin GLFG family.
    Contains 1 peptidase S59 domain.
  • Domain
    Contains G-L-F-G repeats.
  • Post-translational
    modifications
    Isoform 1 to isoform 4 are autoproteolytically cleaved to yield Nup98 and Nup96 or Nup98 only, respectively. Cleaved Nup98 is necessary for the targeting of Nup98 to the nuclear pore and the interaction with Nup96.
  • Cellular localization
    Nucleus > nuclear pore complex. Nucleus membrane. Nup96 is localized to the nucleoplasmic side of the nuclear pore complex, at or near the nucleoplasmic basket.
  • Information by UniProt

Images

  • ab159019 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159019 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159019.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up