Overview

  • Product name
    Recombinant Human NUPL1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EIALRTQKTPPGLQHEYAAPADYFRILVQQFEVQLQQYRQQIEELENHLA TQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENVKVLKEQYLGYRK
    • Amino acids
      323 to 422
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160668 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA0410
    • Nucleoporin like 1
    • Nucleoporin p58/p45
    • NUPL 1
    • OTTHUMP00000018146
    • OTTHUMP00000042323
    • PRO2463
    see all
  • Relevance
    NUPL1 is a member of the nucleoporin family. It is a component of the nuclear pore complex, a complex required for trafficking across the nuclear membrane.
  • Cellular localization
    Nucleus, nuclear pore complex. Nucleus membrane; Peripheral membrane protein; Cytoplasmic side. Nucleus membrane; Peripheral membrane protein; Nucleoplasmic side. Note: Biased towards cytoplasmic side. Central region of the nuclear pore complex, within the transporter.

Images

  • ab160668 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160668 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160668.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up