Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP22736
    • SpeciesHuman
    • SequenceMPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTAL PSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASAS FKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQ LSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSP SLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPV TSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAK YICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLP SKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDA GDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILR LAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDV PAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPAS CLSRLLGKLPELRTLCTRGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
    • Molecular weight92 kDa including tags
    • Amino acids1 to 598

Specifications

Our Abpromise guarantee covers the use of ab114314 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Early response protein NAK1
    • GFRP
    • GFRP 1
    • GFRP1
    • Growth factor inducible nuclear protein N10
    • Growth Factor Inducible Nuclear Protein NP10
    • Growth Factor Response Protein 1
    • Hbr1
    • HMR
    • Hormone Receptor
    • MGC9485
    • N10
    • N10 nuclear protein
    • NAK 1
    • NAK1
    • Nerve growth factor IB nuclear receptor variant 1
    • NGFIB
    • NP 10
    • NP10
    • NR4A1
    • NR4A1_HUMAN
    • Nuclear hormone receptor NUR/77
    • Nuclear Hormone Receptor TR3
    • Nuclear receptor subfamily 4 group A member 1
    • NUR77
    • NUR77, mouse, homolog of
    • Orphan nuclear receptor HMR
    • Orphan nuclear receptor NR4A1
    • Orphan nuclear receptor TR3
    • Orphan receptor tr3
    • Receptor NGFIB
    • ST 59
    • ST-59
    • ST59
    • Steroid receptor TR3
    • Testicular receptor 3
    • TR 3
    • TR3
    • TR3 orphan receptor
    see all
  • FunctionOrphan nuclear receptor. May act concomitantly with NURR1 in regulating the expression of delayed-early genes during liver regeneration. Binds the NGFI-B response element (NBRE) 5'-AAAAGGTCA-3' (By similarity). May inhibit NF-kappa-B transactivation of IL2.
  • Tissue specificityFetal muscle and adult liver, brain and thyroid.
  • Sequence similaritiesBelongs to the nuclear hormone receptor family. NR4 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human NUR77 protein images

  • SDS-PAGE analysis of ab114314 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human NUR77 protein (ab114314)

ab114314 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114314.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"