Overview

  • Product nameRecombinant Human Nurr1 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ6NXU0
    • SpeciesHuman
    • SequenceGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPP GTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFP
    • Molecular weight37 kDa including tags
    • Amino acids71 to 170

Specifications

Our Abpromise guarantee covers the use of ab114341 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HZF 3
    • HZF3
    • Immediate-early response protein NOT
    • Intermediate early receptor protein
    • NGFI B/nur77 beta type transcription factor homolog
    • NOT
    • Nr4a2
    • NR4A2_HUMAN
    • nuclear receptor of T cells
    • nuclear receptor related 1
    • Nuclear receptor subfamily 4 group A member 2
    • Nur related protein 1 homolog
    • nur related protein-1, human homolog of
    • Nurr 1
    • Orphan nuclear receptor NR4A2
    • Orphan nuclear receptor NURR1
    • RNR 1
    • RNR1
    • T cell nuclear receptor NOT
    • T-cell nuclear receptor NOT
    • TINUR
    • Transcriptionally inducible nuclear receptor
    • Transcriptionally inducible nuclear receptor related
    • Transcriptionally inducible nuclear receptor related 1
    • Transcriptionally-inducible nuclear receptor
    see all
  • FunctionTranscriptional regulator which is important for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons during development. It is crucial for expression of a set of genes such as SLC6A3, SLC18A2, TH and DRD2 which are essential for development of mdDA neurons.
  • Tissue specificityExpressed in a number of cell lines of T-cell, B-cell and fibroblast origin. Strong expression in brain tissue.
  • Sequence similaritiesBelongs to the nuclear hormone receptor family. NR4 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Developmental stageRapidly and only very transiently expressed after cell activation, during the G0-G1 transition of the cell cycle.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Nurr1 protein images

  • ab114341 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Nurr1 protein (ab114341)

ab114341 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114341.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"