Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSS RLEEDDGDVAMSDAQDGPRVRYNPYTTRPNRRGDTWHDRDRIHVTVRRDR APPERGGAGTSQDGTSKNWFKITIPYGRKYDKAWLLSMIQSKCSVPFTPI EFHYENTRAQFFVEDASTASALKAVNYKILDRENRRISIIINSSAPPHTI LNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRR SCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSG NELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLR LDGHELPPPIAFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDS GDRQGLLDAYHDGACCSLSIPFIPQNPARSSLAEYFKDSRNVKKLKDPTL RFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTLLCFSVNGVFK EVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFAM PAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSA QAFTHLKAKGEIPEVAFMK
    • Amino acids
      1 to 619
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153087 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp667O0311
    • DmNXF1
    • MEX67
    • MEX67, yeast, homolog of
    • Mex67p
    • mRNA export factor TAP
    • Mvb1
    • Nuclear RNA export factor 1
    • Nuclear RNA export factor 1 homolog (S. cerevisiae)
    • nxf 1
    • NXF1
    • NXF1_HUMAN
    • Protein small bristles
    • Sbr
    • TAP
    • Tip associating protein
    • Tip-associated protein
    • Tip-associating protein
    see all
  • Function
    Involved in the nuclear export of mRNA species bearing retroviral constitutive transport elements (CTE) and in the export of mRNA from the nucleus to the cytoplasm. The NXF1-NXT1 heterodimer is involved in the export of HSP70 mRNA in conjunction with THOC4 and THOC5.
  • Tissue specificity
    Expressed ubiquitously.
  • Sequence similarities
    Belongs to the NXF family.
    Contains 4 LRR (leucine-rich) repeats.
    Contains 1 NTF2 domain.
    Contains 1 RRM (RNA recognition motif) domain.
    Contains 1 TAP-C domain.
  • Domain
    The minimal CTE binding domain consists of an RNP-type RNA binding domain (RBD) and leucine-rich repeats.
    The nucleoporin binding domain consists of a NTF2 domain (also called NTF2-like domain) and a TAP-C domain (also called UBA-like domain). It has 2 nucleoporin-FG-repeats binding sites (one in the NTF2 and the other in the TAP-C domain) which contribute to nucleoporin association and act synergistically to export cellular mRNAs.
    The NTF2 domain is functional only in the presence of NXT1 and is essential for the export of mRNA from the nucleus.
    The TAP-C domain mediates direct interactions with nucleoporin-FG-repeats and is necessary and sufficient for localization of NXF1 to the nuclear rim. The conserved loop 594-NWD-596 of the TAP-C domain has a critical role in the interaction with nucleoporins.
    The leucine-rich repeats are essential for the export of mRNA from the nucleus.
    The RNA-binding domain is a non-canonical RNP-type domain.
  • Cellular localization
    Nucleus > nucleoplasm. Nucleus speckle. Cytoplasm. Localized predominantly in the nucleoplasm and at both the nucleoplasmic and cytoplasmic faces of the nuclear pore complex. Shuttles between the nucleus and the cytoplasm. Travels to the cytoplasm as part of the exon junction complex (EJC) bound to mRNA.
  • Information by UniProt

Images

  • ab153087 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153087 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153087.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up