Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSLPSGHTTGHTDQVVQRRARCWDIYQRRFSSRSEPVNPGMHSSSHQQQD GDAAMHGAHMDSPVRYTPYTISPYNRKGSFRKQDQTHVNMEREQKPPERR MEGNMPDGTLGSWFKITVPFGIKYNEKWLLNLIQNECSVPFVPVEFHYEN MHASFFVENASIAYALKNVSGKIWDEDNEKISIFVNPAGIPHFVHRELKS EKVEQIKLAMNQQCDVSQEALDIQRLPFYPDMVNRDTKMASNPRKCMAAS LDVHEENIPTVMSAGEMDKWKGIEPGEKCADRSPVCTTFSDTSSNINSIL ELFPKLLCLDGQQSPRATLCGTEAHKRLPTCKGSFFGSEMLKNLVLQFLQ QYYLIYDSGDRQGLLSAYHDEACFSLSIPFNPEDSAPSSFCKFFKDSRNI KILKDPYLRGELLKHTKLDIVDSLSALPKTQHDLSSFLVDMWYQTEWMLC FSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSSLCIVNDKLFVRDTSHQ GTQSALFTLVPTAFSSSMPAFSQEQQKMLPS
    • Amino acids
      1 to 531
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163296 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Nuclear RNA export factor 3
    • NXF3
    • NXF3_HUMAN
    • OTTHUMP00000023726
    • OTTHUMP00000023727
    • TAP like protein 3
    • TAP-like protein 3
    • TAPL 3
    • TAPL-3
    • TAPL3
    see all
  • Function
    May function as a tissue-specific nuclear mRNA export factor.
  • Tissue specificity
    Expressed at high level in testis and at low level in a small number of tissues.
  • Sequence similarities
    Belongs to the NXF family.
    Contains 1 NTF2 domain.
    Contains 1 RRM (RNA recognition motif) domain.
  • Domain
    Lacks C-terminal domain that mediates direct interactions with nucleoporins.
    Contains a novel CRM1-dependent nuclear export signal that compensates in cis for the loss of the nuclear pore targeting domain.
    The RNA-binding domain is a non-canonical RNP-type domain.
  • Cellular localization
    Nucleus. Cytoplasm. Shuttles between the nucleus and the cytoplasm.
  • Information by UniProt

Images

  • ab163296 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163296 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163296.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up