Overview

  • Product nameRecombinant Human NXT1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9UKK6
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMASVDFKTYVDQACRAAEEFVNVYYTTMDK RRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPV HDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIAS DCFRFQDWAS
    • Molecular weight18 kDa including tags
    • Amino acids1 to 160
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107147 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    Purified by using conventional chromatography
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • MTR2
    • MTR2, yeast, homolog of
    • NTF2 like export factor 1
    • NTF2 related export protein 1
    • NTF2-related export protein 1
    • NUTF like export factor 1
    • NXT1
    • NXT1_HUMAN
    • P15
    • Protein P15
    see all
  • FunctionStimulator of protein export for NES-containing proteins. Also plays a role in the nuclear export of U1 snRNA, tRNA, and mRNA. The NXF1-NXT1 heterodimer is involved in the export of HSP70 mRNA in conjunction with THOC4 and THOC5.
  • Sequence similaritiesContains 1 NTF2 domain.
  • Cellular localizationNucleus. Cytoplasm. Shuttles between the nucleus and the cytoplasm.
  • Information by UniProt

Recombinant Human NXT1 protein images

  • ab107147 at 3 µg analysed by 15% SDS PAGE.

References for Recombinant Human NXT1 protein (ab107147)

ab107147 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107147.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"