Overview

  • Product name
    Recombinant Human NXT1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMASVDFKTYVDQACRAAEEFVNVYYTTMDK RRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPV HDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIAS DCFRFQDWAS
    • Molecular weight
      18 kDa including tags
    • Amino acids
      1 to 160
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107147 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    Purified by using conventional chromatography
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • MTR2
    • MTR2, yeast, homolog of
    • NTF2 like export factor 1
    • NTF2 related export protein 1
    • NTF2-related export protein 1
    • NUTF like export factor 1
    • NXT1
    • NXT1_HUMAN
    • P15
    • Protein P15
    see all
  • Function
    Stimulator of protein export for NES-containing proteins. Also plays a role in the nuclear export of U1 snRNA, tRNA, and mRNA. The NXF1-NXT1 heterodimer is involved in the export of HSP70 mRNA in conjunction with THOC4 and THOC5.
  • Sequence similarities
    Contains 1 NTF2 domain.
  • Cellular localization
    Nucleus. Cytoplasm. Shuttles between the nucleus and the cytoplasm.
  • Information by UniProt

Images

  • ab107147 at 3 µg analysed by 15% SDS PAGE.

References

ab107147 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab107147.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up