Overview

  • Product name
    Recombinant Human OA1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTQAGRRGPGTPEPRPRTQPMASPRLGTFCCPTRDAATQLVLSFQPRAFH ALCLGSGGLRLALGLLQLLPGRRPAGPGSPATSPPASVRILRAAAACDLL GCLGMVIRSTVWLGFPNFVDSVSDMNHTEIWPAAFCVGSAMWIQLLYSAC FWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLYYPS VSRCERGLDHAIPHYVTMYLPLLLVLVANPILFQKTVTAVASLLKGRQGI YTENERRMGAVIKIRFFKIMLVLIICWLSNIINESLLFYLEMQTDINGGS LKPVRTAAKTTWFIMGILNPAQGFLLSLAFYGWTGCSLGFQSPRKEIQWE SLTTSAAEGAHPSPLMPHENPASGKVSQVGGQTSDEALSMLSEGSDASTI EIHTASESCNKNEGDPALPTHGDL
    • Amino acids
      1 to 424
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159020 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ALBINISM OCULAR TYPE I
    • G protein coupled receptor 143
    • G-protein coupled receptor 143
    • GP143_HUMAN
    • GPR143
    • MOA1
    • NETTLESHIP FALLS TYPE OCULAR ALBINISM
    • Ocular albinism type 1 protein
    • Ocular albinism type 1 protein homolog
    • Ocular albinism1 Nettleship Falls type
    see all
  • Function
    Receptor for tyrosine, L-DOPA and dopamine. After binding to L-DOPA, stimulates Ca(2+) influx into the cytoplasm, increases secretion of the neurotrophic factor SERPINF1 and relocalizes beta arrestin at the plasma membrane; this ligand-dependent signaling occurs through a G(q)-mediated pathway in melanocytic cells. Its activity is mediated by G proteins which activate the phosphoinositide signaling pathway. Plays also a role as an intracellular G protein-coupled receptor involved in melanosome biogenesis, organization and transport.
  • Tissue specificity
    Expressed at high levels in the retina, including the retinal pigment epithelium (RPE), and in melanocytes. Weak expression is observed in brain and adrenal gland.
  • Involvement in disease
    Albinism ocular 1
    Nystagmus congenital X-linked 6
  • Sequence similarities
    Belongs to the G-protein coupled receptor OA family.
  • Domain
    The cytoplasmic domain 3 and the C-terminus tail domain contain the lysosomal sorting signals and are necessary and sufficient for intracellular retention and delivery to lysosomal and melanosomal, respectively in melanocytic and non-melanocytic cells.
  • Post-translational
    modifications
    Glycosylated.
    Phosphorylated.
  • Cellular localization
    Melanosome membrane. Lysosome membrane. Apical cell membrane. Distributed throughout the endo-melanosomal system but most of endogenous protein is localized in unpigmented stage II melanosomes. Its expression on the apical cell membrane is sensitive to tyrosine (PubMed:18828673).
  • Information by UniProt

Images

  • ab159020 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159020 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159020.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up