Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP00973-p41
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMMDLRNTPAKSLDKFIEDYLLPDTCFRMQI NHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVV FLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPR ALSFVLSSLQLGEGVEFDVLPAFDALGQLTGSYKPNPQIYVKLIEECTDL QKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQY ALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKN PIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYP CFKNWDGSPVSSWILLVRPPASSLPFIPAPLHEA
    • Molecular weight44 kDa including tags
    • Amino acids1 to 364
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116476 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    ab116476 is purified by proprietary chromatographic techniques.
  • FormLiquid
  • Additional notesab116476 although stable 4°C for 4 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • (2 5')oligo(A) synthetase 1
    • (2-5'')oligo(A) synthase 1
    • 2 5 Oligoadenylate Synthetase 1
    • 2 5' oligo A synthase 1
    • 2 5' oligo A synthetase 1
    • 2 5A synthase 1
    • 2 5A synthetase 1
    • 2' 5' oligo A synthetase 1
    • 2' 5' oligoadenylate synthetase 1
    • 2' 5' oligoadenylate synthetase 1 40/46kDa
    • 2' 5' oligoisoadenylate synthetase 1
    • 2''-5''-oligoadenylate synthase 1
    • 2'5' oligo A synthetase 1
    • 2'5' oligoadenylate synthetase 1
    • 2'5' oligoisoadenylate synthetase 1
    • 2-5A synthase 1
    • E18/E16
    • IFI 4
    • IFI4
    • OAS 1
    • OAS1
    • OAS1_HUMAN
    • OIAS
    • OIASI
    • p46/p42 OAS
    see all
  • FunctionMay play a role in mediating resistance to virus infection, control of cell growth, differentiation, and apoptosis.
  • Sequence similaritiesBelongs to the 2-5A synthase family.
  • Cellular localizationMitochondrion. Nucleus. Microsome. Endoplasmic reticulum. Associated with different subcellular fractions such as mitochondrial, nuclear, and rough/smooth microsomal fractions.
  • Information by UniProt

References for Recombinant Human OAS1 protein (ab116476)

ab116476 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116476.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"