Overview

  • Product name
    Recombinant Human OASL protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALMQELYSTPASRLDSFVAQWLQPHREWKEEVLDAVRTVEEFLRQEHFQ GKRGLDQDVRVLKVVKVGSFGNGTVLRSTREVELVAFLSCFHSFQEAAKH
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160131 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2' 5' oligoadenylate synthetase like
    • 2''-5''-OAS-related protein
    • 2''-5''-OAS-RP
    • 2''-5''-oligoadenylate synthase-like protein
    • 2'-5' oligoadenylate synthetase-like 2
    • 2'-5'-oligoadenylate synthetase-like
    • 59 kDa 2' 5' oligoadenylate synthetase like protein
    • 59 kDa 2''-5''-oligoadenylate synthase-like protein
    • 59 kDa 2'-5'-oligoadenylate synthetase-like protein
    • M1204
    • Mmu-OASL
    • OASL
    • OASL_HUMAN
    • Oasl2
    • p59 OASL
    • p59OASL
    • THYROID HORMONE RECEPTOR INTERACTOR 14
    • Thyroid receptor interacting protein 14
    • Thyroid receptor-interacting protein 14
    • TR-interacting protein 14
    • TRIP-14
    • TRIP14
    see all
  • Function
    Does not have 2'-5'-OAS activity, but can bind double-stranded RNA. Displays antiviral activity against encephalomyocarditis virus (EMCV) and hepatitis C virus (HCV) via an alternative antiviral pathway independent of RNase L.
  • Tissue specificity
    Expressed in most tissues, with the highest levels in primary blood Leukocytes and other hematopoietic system tissues, colon, stomach and to some extent in testis.
  • Sequence similarities
    Belongs to the 2-5A synthase family.
    Contains 2 ubiquitin-like domains.
  • Domain
    The ubiquitin-like domains are essential for its antiviral activity.
  • Cellular localization
    Cytoplasm and Nucleus > nucleolus. Cytoplasm.
  • Information by UniProt

Images

  • ab160131 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160131 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160131.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up