Overview

  • Product name
    Recombinant Human OATP2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      YISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDAC TRKFYFFVAIQVLNLFFSALGGTSHVMLIVKIVQPELKSL
    • Molecular weight
      36 kDa including tags
    • Amino acids
      481 to 570

Specifications

Our Abpromise guarantee covers the use of ab112394 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    ELISA

    SDS-PAGE

    Western blot

    Other

  • Form
    Liquid
  • Additional notes
    Best to use within three months from the date of receipt of this protein.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • Liver-specific organic anion transporter 1
    • LST-1
    • LST1
    • OATP-2
    • OATP-C
    • OATP1B1
    • OATPC
    • SLC21A6
    • SLCO1B1
    • SO1B1_HUMAN
    • Sodium-independent organic anion-transporting polypeptide 2
    • Solute carrier family 21 member 6
    • Solute carrier organic anion transporter family member 1B1
    see all
  • Function
    Mediates the Na(+)-independent uptake of organic anions such as pravastatin, taurocholate, methotrexate, dehydroepiandrosterone sulfate, 17-beta-glucuronosyl estradiol, estrone sulfate, prostaglandin E2, thromboxane B2, leukotriene C3, leukotriene E4, thyroxine and triiodothyronine. May play an important role in the clearance of bile acids and organic anions from the liver.
  • Tissue specificity
    Highly expressed in liver. Not detected in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocyte.
  • Sequence similarities
    Belongs to the organo anion transporter (TC 2.A.60) family.
    Contains 1 Kazal-like domain.
  • Cellular localization
    Basolateral cell membrane. Detected in basolateral membranes of hepatocytes.
  • Information by UniProt

Recombinant Human OATP2 protein images

  • 12.5% SDS-PAGE analysis of OATP2 protein (ab112394), stained with Coomassie Blue.

References for Recombinant Human OATP2 protein (ab112394)

ab112394 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112394.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up