Recombinant Human OBFC2B protein (ab163963)

Overview

  • Product name
    Recombinant Human OBFC2B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSI NISVWDDVGNLIQPGDIIRLTKGYASVFKGCLTLYTGRGGDLQKIGEFCM VYSEVPNFSEPNPEYSTQQAPNKAVQNDSNPSASQPTTGPSAASPASENQ NGNGLSAPPGPGGGPHPPHTPSHPPSTRITRSQPNHTPAGPPGPSSNPVS NGKETRRSSKR
    • Amino acids
      1 to 211
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163963 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2610036N15Rik
    • hSSB1
    • LP3587
    • MGC125161
    • MGC2731
    • MGC30353
    • Nabp2
    • Nucleic acid binding protein 2
    • Oligonucleotide/oligosaccharide binding fold containing 2B
    • Oligonucleotide/oligosaccharide binding fold containing protein 2B
    • RGD1308158
    • Sensor of single strand DNA complex subunit B1
    • Sensor of ssDNA subunit B1
    • Single stranded DNA binding protein 1
    • SOSS complex subunit B1
    • SSB1
    see all
  • Relevance
    Single-stranded DNA (ssDNA)-binding proteins, such as OBFC2B, are ubiquitous and essential for a variety of DNA metabolic processes, including replication, recombination, and detection and repair of damage. OBFC2B plays an important role in DNA damage response. It influences diverse endpoints in the cellular DNA damage response, including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. It associates with DNA lesions, and enables the efficient activation of ATM and consequent phosphorylation of downstream proteins.
  • Cellular localization
    Nuclear. Localizes to nuclear foci following DNA damage.

Images

  • ab163963 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163963 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163963.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up