Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LGPRGPLGLFRPEPRGASPPGPQVRSLEGTSFLLREAPARPVGSAPWTQS FCTRIRRSADSGQSSFTTELSTQTVNFGTVGETVTLHICPDRDGDEAAQP
    • Amino acids
      6521 to 6620
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164480 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BC046431
    • Gm878
    • KIAA1556
    • KIAA1639
    • OBSCN
    • OBSCN_HUMAN
    • Obscurin
    • Obscurin-MLCK
    • Obscurin-myosin light chain kinase
    • Obscurin-RhoGEF
    • OTTMUSG00000005786
    • UNC89
    see all
  • Function
    Involved in myofibrillogenesis. Seems to be involved in assembly of myosin into sarcomeric A bands in striated muscle. Isoform 3 together with ANK1 isoform Mu17/Ank1.5 may provide a molecular link between the sarcoplasmic reticulum and myofibrils.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
    Contains 1 DH (DBL-homology) domain.
    Contains 3 fibronectin type-III domains.
    Contains 55 Ig-like (immunoglobulin-like) domains.
    Contains 1 IQ domain.
    Contains 2 PH domains.
    Contains 2 protein kinase domains.
    Contains 1 SH3 domain.
  • Cellular localization
    Cytoplasm > myofibril > sarcomere > M line. Cytoplasm > myofibril > sarcomere > Z line. In differentiating skeletal muscle cells, isoform 3 primarily localizes to the sarcomeric M-line and less frequently to the Z-disk. Isoform 3 colocalizes with ANK1 isoform Mu17/ank1.5 at the M-line in differentiated skeletal muscle cells.
  • Information by UniProt

Images

  • ab164480 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164480 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164480.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up