Recombinant Human Occludin protein (ab114190)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ16625
    • SpeciesHuman
    • SequenceITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESE EYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT
    • Molecular weight37 kDa including tags
    • Amino acids423 to 522

Specifications

Our Abpromise guarantee covers the use of ab114190 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BLCPMG
    • FLJ08163
    • FLJ18079
    • FLJ77961
    • FLJ94056
    • MGC34277
    • Occludin
    • Ocln
    • OCLN_HUMAN
    • Tight junction protein occludin
    see all
  • FunctionMay play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier. It is able to induce adhesion when expressed in cells lacking tight junctions.
  • Tissue specificityLocalized at tight junctions of both epithelial and endothelial cells. Highly expressed in kidney. Not detected in testis.
  • Involvement in diseaseDefects in OCLN are the cause of band-like calcification with simplified gyration and polymicrogyria (BLCPMG) [MIM:251290]; also known as pseudo-TORCH syndrome. BLCPMG is a neurologic disorder with characteristic clinical and neuroradiologic features that mimic intrauterine TORCH infection in the absence of evidence of infection. Affected individuals have congenital microcephaly, intracranial calcifications, and severe developmental delay.
  • Sequence similaritiesBelongs to the ELL/occludin family.
    Contains 1 MARVEL domain.
  • DomainThe C-terminal is cytoplasmic and is important for interaction with ZO-1. Sufficient for the tight junction localization. Involved in the regulation of the permeability barrier function of the tight junction (By similarity). The first extracellular loop participates in an adhesive interaction.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR. Dephosphorylated by PTPRJ. The tyrosine phosphorylation on Tyr-398 and Tyr-402 reduces its ability to interact with TJP1.
  • Cellular localizationMembrane. Cell junction > tight junction.
  • Information by UniProt

Recombinant Human Occludin protein images

  • ab114190 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Occludin protein (ab114190)

ab114190 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114190.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"