Recombinant Human OCIAD2 protein (denatured) (ab156356)

Overview

  • Product name
    Recombinant Human OCIAD2 protein (denatured)
  • Protein length
    Full length protein
  • Description
    Recombinant Human OCIAD2 protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMASASARGNQDKDAHFPPPSKQSLLFC PKSKLHIHRAEISKIMRECQEESFWKRALPFSLVSMLVTQGLVYQGYLAA NSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFHFFEDQLRGAGFGPQHN RHCLLTCEECKIKHGLSEKGDSQPSAS
    • Molecular weight
      19 kDa including tags
    • Amino acids
      1 to 154
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156356 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • OCAD2_HUMAN
    • OCIA domain containing 2
    • OCIA domain-containing protein 2
    • OCIAD2
    • ovarian carcinoma immunoreactive antigen
    • Ovarian carcinoma immunoreactive antigen like protein
    • Ovarian carcinoma immunoreactive antigen-like protein
    see all
  • Sequence similarities
    Contains 1 OCIA domain.
  • Cellular localization
    Endosome.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab156356.

References

ab156356 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156356.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up